DPCR1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DPCR1 Polyclonal antibody, PBS Only (31420-1-PBS)

• 

  WB analysis using 31420-1-AP (same clone as 31420-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31420-1-AP (DPCR1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31420-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 31420-1-AP (same clone as 31420-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 31420-1-AP (DPCR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31420-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 31420-1-AP (same clone as 31420-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 31420-1-AP (DPCR1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31420-1-PBS in a different storage buffer formulation.

DPCR1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 31420-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

31420-1-PBS targets DPCR1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33318

  Product name: Recombinant human DPCR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 70-448 aa of NM_080870

  Sequence: DHIVLHSGQRPPELPKSTEIHEQKRHCNTTRHSKPTDKPTGNSKTIDHKSSTDNHEAPPTSEENSSNQGKDPMIRNQRSVDPADSTTTHKESAGKKHITPAPKSKINCRKSTTGKSTVTRKSDKTGRPLEKSMSTLDKTSTSSHKTTTSFHNSGNSQTKQKSTSFPEKITAASKTTYKTTGTPEESEKTEDSRTTVASDKLLTKTTKNIQETISANELTQSLAEPTEHGGRTANENNTPSPAEPTENRERTANENKKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKGIHAGQMGENDSFPAWA

• Full Name: diffuse panbronchiolitis critical region 1
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: NM_080870
• Gene Symbol: DPCR1
• Gene ID (NCBI): 135656
• RRID: AB_3669973
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q3MIW9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Diffuse panbronchiolitis critical region 1 (DPCR1) is located in the major histocompatibility complex (MHC) class I. DPCR1 is downregulated in invasive pituitary adenoma compared with that in non-invasive tumors, but upregulated in the precursor of gastric carcinogenesis (PMID: 29242154).