DPEP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DPEP1 Polyclonal antibody, PBS Only (12222-1-PBS)

• 

  WB analysis using 12222-1-AP (same clone as 12222-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12222-1-AP (DPEP1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12222-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 12222-1-AP (same clone as 12222-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12222-1-AP (DPEP1 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 12222-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DPEP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12222-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

MBD1, hRDP, EC:3.5.2.6, EC:3.4.13.19, Dehydropeptidase-I

---

Product Information

12222-1-PBS targets DPEP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2907

  Product name: Recombinant human DPEP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-385 aa of BC017023

  Sequence: MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

• Full Name: dipeptidase 1 (renal)
• Calculated Molecular Weight: 411 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC017023
• Gene Symbol: DPEP1
• Gene ID (NCBI): 1800
• RRID: AB_2877837
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16444
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DPEP1(Dipeptidase 1) is also named as MDP, RDP and belongs to the peptidase M19 family. It is a glycoprotein that plays an important role in the regulation of leukotriene activity. DPEP1 converts lekotriene D4 to leukotriene E4.