DPEP1 Monoclonal antibody, PBS Only

• 

  WB analysis of pig pancreas using 68081-1-Ig (same clone as 68081-1-PBS)

  pig pancreas tissue were subjected to SDS PAGE followed by western blot with 68081-1-Ig (DPEP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68081-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 68081-1-Ig (same clone as 68081-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 68081-1-Ig (DPEP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68081-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit kidney using 68081-1-Ig (same clone as 68081-1-PBS)

  rabbit kidney tissue were subjected to SDS PAGE followed by western blot with 68081-1-Ig (DPEP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68081-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat pancreas using 68081-1-Ig (same clone as 68081-1-PBS)

  rat pancreas tissue were subjected to SDS PAGE followed by western blot with 68081-1-Ig (DPEP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68081-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 68081-1-Ig (same clone as 68081-1-PBS)

  WB result of DPEP1 antibody (68081-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DPEP1 transfected HepG2 cells. This data was developed using the same antibody clone with 68081-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 68081-1-Ig (same clone as 68081-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 68081-1-Ig (DPEP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68081-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 68081-1-Ig (same clone as 68081-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 68081-1-Ig (DPEP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68081-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 68081-1-Ig (same clone as 68081-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 68081-1-Ig (DPEP1 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68081-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 68081-1-Ig (same clone as 68081-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using DPEP1 antibody (68081-1-Ig, Clone: 2B4F4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68081-1-PBS in a different storage buffer formulation.

DPEP1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 68081-1-PBS

Clone No.2B4F4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, ELISA

Synonyms

hRDP, EC:3.5.2.6, EC:3.4.13.19, Dehydropeptidase-I, Beta-lactamase

---

Product Information

68081-1-PBS targets DPEP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14591

  Product name: Recombinant human DPEP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-385 aa of BC017023

  Sequence: MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

• Full Name: dipeptidase 1 (renal)
• Calculated Molecular Weight: 411 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC017023
• Gene Symbol: DPEP1
• Gene ID (NCBI): 1800
• RRID: AB_2918818
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16444
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.