DPEP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DPEP2 Polyclonal antibody, PBS Only (16466-1-PBS)

• 

  IHC staining of human kidney using 16466-1-AP (same clone as 16466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16466-1-AP (DPEP2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16466-1-AP (same clone as 16466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16466-1-AP (DPEP2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16466-1-PBS in a different storage buffer formulation.

DPEP2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 16466-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

16466-1-PBS targets DPEP2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9545

  Product name: Recombinant human DPEP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-379 aa of BC024021

  Sequence: CAYTTPGPPRAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVSESS

• Full Name: dipeptidase 2
• Calculated Molecular Weight: 399 aa, 44 kDa
• Observed Molecular Weight: 45 kDa, 50 kDa
• GenBank Accession Number: BC024021
• Gene Symbol: DPEP2
• Gene ID (NCBI): 64174
• RRID: AB_11232414
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4A9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DPEP2(Dipeptidase 2) may play an important role in the regulation of leukotriene activity which converts leukotriene d4 to leukotriene e4. It belongs to the peptidase M19 family. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 53 kDa and 44 kDa.