DPH5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DPH5 Polyclonal antibody (33922-1-AP)

• 

  WB analysis using 33922-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33922-1-AP (DPH5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

DPH5 Polyclonal Antibody for WB, ELISA

Cat No. 33922-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

AD-018, CGI-30, Diphthamide biosynthesis methyltransferase, Diphthine methyl ester synthase, EC:2.1.1.314

---

Tested Applications

• Positive WB detected in: A-204 cells, HL-60 cells, Raji cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33922-1-AP targets DPH5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38953

  Product name: Recombinant human DPH5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-285 aa of NM_001077394.1

  Sequence: WRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGADDQKIAAGTLRQMCTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQSINGL

• Full Name: DPH5 homolog (S. cerevisiae)
• Calculated Molecular Weight: 32kDa，285aa
• Observed Molecular Weight: 26-36 kDa
• GenBank Accession Number: NM_001077394.1
• Gene Symbol: DPH5
• Gene ID (NCBI): 51611
• RRID: AB_3743111
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H2P9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The research background of DPH5 mainly revolves around its key role in diphthamide amide biosynthesis pathway. Diphtheria amide is a highly conserved post-translational modification of eukaryotic translation elongation factor eEF2, which is very important for maintaining translation accuracy and protein synthesis efficiency. Due to modification, the molecular weight is 26-36 kDa. There are also some isoform and ubiquitination modifications.