DPP3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DPP3 Polyclonal antibody, PBS Only (10650-1-PBS)

• 

  WB analysis of mouse thymus using 10650-1-AP (same clone as 10650-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 10650-1-AP (DPP3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10650-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 10650-1-AP (same clone as 10650-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 10650-1-AP (DPP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10650-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 10650-1-AP (same clone as 10650-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 10650-1-AP (DPP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10650-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 10650-1-AP (same clone as 10650-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 10650-1-AP (DPP3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10650-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DPP3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 10650-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

10650-1-PBS targets DPP3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1022

  Product name: Recombinant human DPP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 437-737 aa of BC007221

  Sequence: LWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPEAFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA

• Full Name: dipeptidyl-peptidase 3
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 69 kDa, 83 kDa
• GenBank Accession Number: BC007221
• Gene Symbol: DPP3
• Gene ID (NCBI): 10072
• RRID: AB_2093553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NY33
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DPP3 (dipeptidyl-peptidase 3), also known as DPPIII, is one of the dipeptidyl aminopeptidases, that belongs to the peptidase M49 family. DPP3 is a metalloenzyme containing one Zn2+ ion in its active site. Furthermore, It was shown to have a novel zinc-binding motif ( HELLGH). DPP3 has been reported as an important enkephalin-degrading enzyme in the central nervous system, in human neutrophils.It has 3 isoforms produced by alternative splicing. Increased activity of DPP3 is associated with endometrial and ovarian cancers.