Home
Products
Primary Antibodies
Dermatopontin Polyclonal antibody (10537-1-AP)

Featured Product
KD/KO Validated

Dermatopontin Polyclonal antibody

Dermatopontin Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10537-1-AP

Publications (18)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Dermatopontin, DPT, TRAMP

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of mouse skin using 10537-1-AP
mouse skin tissue were subjected to SDS PAGE followed by western blot with 10537-1-AP (Dermatopontin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of rat skin using 10537-1-AP
rat skin tissue were subjected to SDS PAGE followed by western blot with 10537-1-AP (Dermatopontin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human skeletal muscle using 10537-1-AP
human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10537-1-AP (Dermatopontin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas using 10537-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas using 10537-1-AP (Dermatopontin antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas using 10537-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas using 10537-1-AP (Dermatopontin antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 10537-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 10537-1-AP (Dermatopontin antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 10537-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 10537-1-AP (Dermatopontin antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 10537-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 10537-1-AP (Dermatopontin antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 10537-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 10537-1-AP (Dermatopontin antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat testis using 10537-1-AP
Immunohistochemical analysis of paraffin-embedded rat testis using 10537-1-AP (Dermatopontin antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat testis using 10537-1-AP
Immunohistochemical analysis of paraffin-embedded rat testis using 10537-1-AP (Dermatopontin antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Dermatopontin in ?

Overview

Tested Applications
Product Information
Publications (18)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse skin tissue, rat skin tissue, human skeletal muscle tissue
Positive IHC detected in	human pancreas tissue, rat testis tissue, human testis tissue, human heart tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10537-1-AP targets Dermatopontin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0801 Product name: Recombinant human DPT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC033736 Sequence: MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV Predict reactive species
Full Name	dermatopontin
Calculated Molecular Weight	22 kDa
Observed Molecular Weight	22 kDa
GenBank Accession Number	BC033736
Gene Symbol	DPT/TRAMP
Gene ID (NCBI)	1805
RRID	AB_2230721
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q07507
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DPT (dermatopontin) is an extracellular matrix protein belonging to the dermatopontin family. Skin appears to be the richest source of dermatopontin, comprising about 15 mg/kg of the wet weight. Expression of dermatopontin is not limited to connective tissue, as investigations show that dermatopontin mRNA is expressed in cultured fibroblasts, muscle, heart, pancreas, and lung. Dermatopontin comprises a considerable proportion of the noncollagenous extracellular matrix proteins. It is involved in promotion of cellular adhesion, extracellular matrix assembly, wound healing, and positive modification of the growth inhibition activity of TGF-beta1.

Protocols

Product Specific Protocols
IHC protocol for Dermatopontin antibody 10537-1-AP	Download protocol
WB protocol for Dermatopontin antibody 10537-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-Dermatopontin (DPT) antibody (Cat# 10537-1-AP) has 18 total citations spanning journals including Autophagy, Cell Death Dis, Cardiovasc Res, Oncotarget, Neuro Oncol, Matrix Biol, Int J Cancer, and BMC Cancer. Research fields cover cancer biology (esophageal, breast, thyroid, oral, hepatocellular carcinoma), autophagy regulation, cardiovascular disease, fibrosis, single-cell transcriptomics, osteogenic differentiation, and cardiac fibroblast biology. Applications include IF, IHC, and WB across human, mouse, and rat species.

Species	Application	Title
human	IF	Autophagy WNT2B impairs endosomal trafficking via WASHC5 to inhibit autophagy: a novel non-secretory WNT pathway. Authors - Danqiong Liu View Article
human	IF	Biomark Res Functional heterogeneity of cancer-associated fibroblasts with distinct neoadjuvant immunotherapy plus chemotherapy response in esophageal squamous cell carcinoma Authors - Jun Jiang View Article
human	IF	Neuro Oncol Single-cell transcriptomes reveal the heterogeneity and microenvironment of vestibular schwannoma Authors - Zirong Huo View Article
mouse	IHC	Cardiovasc Res Regulation of Ptbp1-controlled alternative splicing of pyruvate kinase muscle by Liver kinase b1 governs vascular smooth muscle cell plasticity in vivo Authors - Zhaohua Cai View Article
human	IHC	Cell Death Dis DNMT3a-dermatopontin axis suppresses breast cancer malignancy via inactivating YAP Authors - Danrong Ye View Article
human	WB	Int J Oncol NRG1 regulates redox homeostasis via NRF2 in papillary thyroid cancer. Authors - Ting-Ting Zhang KD Validated View Article