DPYS Polyclonal antibody

• 

  WB analysis of HEK-293 using 13237-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13237-1-AP (DPYS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 13237-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 13237-1-AP (DPYS antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 13237-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 13237-1-AP (DPYS antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse kidney using 13237-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13237-1-AP (DPYS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 13237-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13237-1-AP (DPYS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

DPYS Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13237-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

DHP, DHPase, Dihydropyrimidinase, EC:3.5.2.2

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IHC detected in: human liver tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 2 publications below

Product Information

13237-1-AP targets DPYS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3972

  Product name: Recombinant human DPYS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 234-519 aa of BC034395

  Sequence: ITIASAVNCPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHHQAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP

• Full Name: dihydropyrimidinase
• Calculated Molecular Weight: 519 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC034395
• Gene Symbol: DPYS
• Gene ID (NCBI): 1807
• RRID: AB_2094329
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14117
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DPYS(Dihydropyrimidinase)also known as 5,6-dihydropyrimidine amidohydrolase, or DHP, is the second enzyme in uracil and thymine catabolism. However, in normal human extrahepatic tissues, DPYS, rather than dihydrouracil dehydrogenase, is the rate-limiting enzyme in the pyrimidine base catabolic pathway. DHPase in solid tumors is increased when compared with normal tissues(PMID: 8307005).Defects in DPYS are the cause of dihydropyrimidinase deficiency (DHPD).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; Dihydropyrimidinase protects from DNA replication stress caused by cytotoxic metabolites.; Authors - Jihane Basbous ; KD Validated
human	WB,IHC	Cancer Cell Int; Identification of crucial genes of pyrimidine metabolism as biomarkers for gastric cancer prognosis.; Authors - Zhengxin Wu
human	IHC	Arthritis Res Ther; Investigation of ferroptosis-associated molecular subtypes and immunological characteristics in lupus nephritis based on artificial neural network learning; Authors - Li Zhang