DPYSL2 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP00886-2

  Sandwich ELISA standard curve of MP00886-2, Human CRMP2 Recombinant Matched Antibody Pair - PBS only. 83990-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag5987. 83990-4-PBS was HRP conjugated as the detection antibody. Range: 1.95-125 ng/mL.

• 

  Sample test of MP00886-2

  The mean CRMP2 concentration was determined to be 167.28 ng/mL in K-562 cell extract based on a 2.10 mg/mL extract load and 105.42 ng/mL in U-87 MG cell extract based on a 3.40 mg/mL extract load.

DPYSL2 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83990-4-PBS

Clone No.241088B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

DRP2, Dihydropyrimidinase-related protein 2, DHPRP2, CRMP-2, CRMP2

---

Product Information

83990-4-PBS targets DPYSL2 as part of a matched antibody pair:

MP00886-2: 83990-3-PBS capture and 83990-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5987

  Product name: Recombinant human DPYSL2 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 224-572 aa of BC067109

  Sequence: VLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

• Full Name: dihydropyrimidinase-like 2
• Calculated Molecular Weight: 62 kDa
• GenBank Accession Number: BC067109
• Gene Symbol: CRMP2
• Gene ID (NCBI): 1808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16555
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.