Product Information
31777-1-PBS targets DRAM in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33711 Product name: Recombinant human DRAM protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 30-90 aa of BC018435 Sequence: AVLSGHVNPFLPYISDTGTTPPESGIFGFMINFSAFLGAATMYTRYKIVQKQNQTCYFSTP Predict reactive species |
| Full Name | damage-regulated autophagy modulator |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC018435 |
| Gene Symbol | DRAM |
| Gene ID (NCBI) | 55332 |
| RRID | AB_3670110 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8N682 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Damage-regulated autophagy modulator (DRAM) is a lysosomal membrane protein of autophagy that enriches in lung tissue and plays a central role in p53/TP53-mediated apoptosis (PMID: 16839881), which increased autophagy flux by promoting lysosomal acidification and protease activation (PMID: 23696801). It has 238 amino acids and six hydrophobic transmembrane regions. Reports show DRAM to be downregulated in squamous cancers, indicating a selective pressure to lose DRAM during tumor development (PMID: 17102582). Overexpression of DRAM1 can promote mitophagy and enhance mitochondrial function (PMID: 31204316).
