DRD1 Recombinant monoclonal antibody, PBS Only

• 

DRD1 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 83037-6-PBS

Clone No.241782C10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

D(1A) dopamine receptor, DADR, Dopamine D1 receptor, dopamine receptor D1

---

Product Information

83037-6-PBS targets DRD1 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12366

  Product name: Recombinant human DRD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 338-446 aa of BC074978

  Sequence: RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT

• Full Name: dopamine receptor D1
• Calculated Molecular Weight: 446 aa, 49 kDa
• GenBank Accession Number: BC074978
• Gene Symbol: DRD1
• Gene ID (NCBI): 1812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21728
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.