DRD2 Polyclonal antibody

• 

  IHC staining of mouse cerebellum using 22022-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 22022-1-AP (DRD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 22022-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22022-1-AP (DRD2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 22022-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22022-1-AP (DRD2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DRD2 Polyclonal Antibody for IHC, ELISA

Cat No. 22022-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF, ELISA

Synonyms

D(2) dopamine receptor, D2 dopamine receptor, D2DR, D2R, Dopamine D2 receptor

---

Tested Applications

• Positive IHC detected in: mouse brain tissue, mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

22022-1-AP targets DRD2 in IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16821

  Product name: Recombinant human DRD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 200-384 aa of BC021195

  Sequence: VPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFII

• Full Name: dopamine receptor D2
• Calculated Molecular Weight: 443 aa, 51 kDa
• GenBank Accession Number: BC021195
• Gene Symbol: DRD2
• Gene ID (NCBI): 1813
• RRID: AB_2878972
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14416
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Ophthalmic Res; 7-Methylxanthine Influences the Behavior of ADORA2A-DRD2 Heterodimers in Human Retinal Pigment Epithelial Cells.; Authors - Yuzhuo Fan