DRG1 Polyclonal antibody

• 

  WB analysis using 13190-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13190-1-AP (DRG1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 13190-1-AP

  WB result of DRG1 antibody (13190-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DRG1 transfected K-562 cells.

• 

  WB analysis of PC-12 using 13190-1-AP

  PC-12 cells were subjected to SDS PAGE followed by western blot with 13190-1-AP (DRG1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 13190-1-AP

  IP result of anti-DRG1 (IP:13190-1-AP, 4ug; Detection:13190-1-AP 1:600) with K-562 cells lysate 4400 ug.

• 

  IHC staining of human thyroid cancer using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skeletal muscle using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skeletal muscle using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 13190-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 13190-1-AP

  Immunofluorescent analysis of HepG2 cells using 13190-1-AP (DRG1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

DRG1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13190-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

TRAFAC GTPase DRG1, Neural precursor cell expressed developmentally down-regulated protein 3, EC:3.6.5.-, DRG-1, DRG 1

---

Tested Applications

• Positive WB detected in: HepG2 cells, PC-12 cells, K-562 cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human thyroid cancer tissue, mouse kidney tissue, rat kidney tissue, rat skeletal muscle tissue, human colon cancer tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IP: See 1 publications below

Product Information

13190-1-AP targets DRG1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3866

  Product name: Recombinant human DRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-367 aa of BC020803

  Sequence: MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEAAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK

• Full Name: developmentally regulated GTP binding protein 1
• Calculated Molecular Weight: 367 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC020803
• Gene Symbol: DRG1
• Gene ID (NCBI): 4733
• RRID: AB_2095275
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y295
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Chem Biol; The Jumonji-C oxygenase JMJD7 catalyzes (3S)-lysyl hydroxylation of TRAFAC GTPases.; Authors - Suzana Markolovic
human	WB,IP	Structure; Rewiring protein binding specificity in paralogous DRG/DFRP complexes; Authors - Christian A E Westrip