DSC2 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of Caco-2 using 84985-1-RR (same clone as 84985-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Caco-2 cells using DSC2 antibody (84985-1-RR, Clone: 241084G9 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84985-1-PBS in a different storage buffer formulation.

DSC2 Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 84985-1-PBS

Clone No.241084G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

Desmocollin 2, Desmocollin 3, CDHF2, Cadherin family member 2, ARVD11

---

Product Information

84985-1-PBS targets DSC2 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4956

  Product name: Recombinant human DSC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-357 aa of BC063291

  Sequence: LIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTR

• Full Name: desmocollin 2
• Calculated Molecular Weight: 100 kDa
• GenBank Accession Number: BC063291
• Gene Symbol: Desmocollin 2
• Gene ID (NCBI): 1824
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q02487
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Desmocollin 2 (DSC2) is a member of the desmocollin subfamily of the cadherin superfamily. The desmocollins (DSC1-3), along with the desmogleins (DSG1-4), are found primarily in epithelial and cardiac muscle where they constitute the adhesive proteins of the intercellular desmosome junctions and are required for cell adhesion and desmosome formation. Mutations in the DSC2 gene are associated with arrhythmogenic right ventricular dysplasia-11.