Desmocollin 2 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Desmocollin 2 Recombinant monoclonal antibody, PBS Only (84985-1-PBS)

Desmocollin 2 Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 84985-1-PBS

Clone No.241084G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

DSC2, 241084G9, ARVD11, Cadherin family member 2, CDHF2

• 

  IF Staining of Caco-2 using 84985-1-RR (same clone as 84985-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Caco-2 cells using DSC2 antibody (84985-1-RR, Clone: 241084G9 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84985-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 84985-1-RR (same clone as 84985-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using DSC2 antibody (84985-1-RR, Clone: 241084G9 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84985-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 84985-1-RR (same clone as 84985-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using DSC2 antibody (84985-1-RR, Clone: 241084G9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84985-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 84985-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 84985-1-PBS against Human DSC2 was performed. The affinity constant is 174 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

84985-1-PBS targets Desmocollin 2 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4956

  Product name: Recombinant human DSC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-357 aa of BC063291

  Sequence: LIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTR

• Full Name: desmocollin 2
• Calculated Molecular Weight: 100 kDa
• GenBank Accession Number: BC063291
• Gene Symbol: Desmocollin 2
• Gene ID (NCBI): 1824
• RRID: AB_3743913
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q02487
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Desmocollin 2 (DSC2) is a member of the desmocollin subfamily of the cadherin superfamily. The desmocollins (DSC1-3), along with the desmogleins (DSG1-4), are found primarily in epithelial and cardiac muscle where they constitute the adhesive proteins of the intercellular desmosome junctions and are required for cell adhesion and desmosome formation. Mutations in the DSC2 gene are associated with arrhythmogenic right ventricular dysplasia-11.