DSE Polyclonal antibody

• 

  IHC staining of human ovary tumor using 10452-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10452-1-AP (DSE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 10452-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10452-1-AP (DSE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DSE Polyclonal Antibody for IHC, ELISA

Cat No. 10452-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF, IHC, ELISA

Synonyms

dermatan sulfate epimerase, DS epimerase, DSE, DSEPI, SART 2, SART2

---

Tested Applications

• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

10452-1-AP targets DSE in IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0695

  Product name: Recombinant human DSE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 659-958 aa of BC039245

  Sequence: RAAYLFIGPSIDVQSFTVHGDSQQLDVFIATSKHAYATYLWTGEATGQSAFAQVIADRHKILFDRNSAIKSSIVPEVKDYAAIVEQNLQHFKPVFQLLEKQILSRVRNTASFRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYTRLFLILNIAIFFVMLAMQLTYFQRAQSLHGQRCLYAVLLIDSCILLWLYSSCSQSQC

• Full Name: dermatan sulfate epimerase
• Calculated Molecular Weight: 958 aa, 110 kDa
• GenBank Accession Number: BC039245
• Gene Symbol: DSE
• Gene ID (NCBI): 29940
• RRID: AB_2093288
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UL01
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DSE, also named as SART2 and DSEPI, is an enzyme that converts D-glucuronic acid to L-iduronic acid residues in dermatan sulphate biosynthesis. It is also identified to be a tumour-associated antigen. DSE is recognized by cytotoxic T cells (CTLs) and its enhanced expression in many cancers has been reported. DSE is a potential candidate for a tumour antigen with immunogenicity.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC, IF	Liver Int; Expression of chondroitin-glucuronate C5-epimerase and cellular immune responses in patients with hepatocellular carcinoma.; Authors - Mizukoshi Eishiro E