DSG2 Polyclonal antibody

• 

  WB analysis using 29206-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 29206-1-AP (DSG2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 29206-1-AP

  WB result of DSG2 antibody (29206-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DSG2 transfected HeLa cells.

• 

  WB analysis of HEK-293 using 29206-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 29206-1-AP (DSG2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 29206-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using DSG2 antibody (29206-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of A431 using 29206-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using DSG2 antibody (29206-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

DSG2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 29206-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

ARVC10, ARVD10, Cadherin family member 5, CDHF5, Desmoglein 2

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29206-1-AP targets DSG2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20633

  Product name: Recombinant human DSG2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 345-608 aa of BC099655

  Sequence: MKNLDFSVIVANKAAFHKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISIYVSESMDRSSKGQIIGNFQAFDEDTGLPAHARYVKLEDRDNWISVDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKTITGTVLINVEDINDNCPTLIEPVQTICHDAEYVNVTAEDLDGHPNSGPFSFSVIDKPPGMAEKWKIARQESTSVLLQQSEKKLGRSEIQFLISDNQGFSCPEKQVLTLTVCECLHGSGCREAQHDSYV

• Full Name: desmoglein 2
• Calculated Molecular Weight: 1118 aa, 122 kDa
• Observed Molecular Weight: 150-160 kDa
• GenBank Accession Number: BC099655
• Gene Symbol: DSG2
• Gene ID (NCBI): 1829
• RRID: AB_2918248
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14126
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.