DTL Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DTL Polyclonal antibody, PBS Only (12896-1-PBS)

• 

  WB analysis of HeLa using 12896-1-AP (same clone as 12896-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12896-1-AP (DTL antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12896-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 12896-1-AP (same clone as 12896-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 12896-1-AP (DTL antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12896-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 12896-1-AP (same clone as 12896-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 12896-1-AP (DTL antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12896-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 12896-1-AP (same clone as 12896-1-PBS)

  IP result of anti-DTL (IP:12896-1-AP, 3ug; Detection:12896-1-AP 1:500) with mouse testis tissue lysate 8000ug. This data was developed using the same antibody clone with 12896-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12896-1-AP (same clone as 12896-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 12896-1-AP (DTL antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12896-1-PBS in a different storage buffer formulation.

DTL Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 12896-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

CDT2, CDW1, DCAF2, DDB1- and CUL4-associated factor 2, Denticleless protein homolog

---

Product Information

12896-1-PBS targets DTL in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3589

  Product name: Recombinant human DTL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-348 aa of BC033540

  Sequence: MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSAPNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYRQVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCTDDNIYMFNMTGLKTSPVAIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIWKVST

• Full Name: denticleless homolog (Drosophila)
• Calculated Molecular Weight: 730 aa, 79 kDa
• Observed Molecular Weight: 79 kDa
• GenBank Accession Number: BC033540
• Gene Symbol: DTL
• Gene ID (NCBI): 51514
• RRID: AB_10639514
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZJ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDT2, also named as L2DTL or RAMP, is one of the substrate receptors of the Cullin Ring Ubiquitin Ligase 4 that targets for ubiquitin mediated degradation a number of substrates, such as CDT1, p21 and CHK1, involved in the regulation of cell cycle and survival. CDT2 overexpression was reported in breast (PMID: 18542055), gastric (PMID: 19672268) and ovarian carcinomas (PMID: 23995842) and rhabdomyosarcomas (PMID: 19235922) and associated with the aggressiveness of hepatocellular carcinomas (PMID: 17106265).