DTX2 Polyclonal antibody

• 

  IHC staining of human testis using 18565-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 18565-1-AP (DTX2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 18565-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 18565-1-AP (DTX2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human hepatocirrhosis using 18565-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 18565-1-AP (DTX2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 18565-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 18565-1-AP (DTX2 antibody) at dilution of 1:50 (under 40x lens).

DTX2 Polyclonal Antibody for IHC, ELISA

Cat No. 18565-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

deltex homolog 2 (Drosophila), Deltex2, DTX2, hDTX2, KIAA1528, Protein deltex 2, RING finger protein 58, RNF58

---

Tested Applications

• Positive IHC detected in: human testis tissue, human hepatocirrhosis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

18565-1-AP targets DTX2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4376

  Product name: Recombinant human DTX2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 322-622 aa of BC008856

  Sequence: PMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKEATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLSTASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ

• Full Name: deltex homolog 2 (Drosophila)
• Calculated Molecular Weight: 67 kDa
• GenBank Accession Number: BC008856
• Gene Symbol: DTX2
• Gene ID (NCBI): 113878
• RRID: AB_10643380
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UW9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Sci; Ubiquitination of NOTCH2 by DTX3 suppresses the proliferation and migration of human esophageal carcinoma.; Authors - Xin-Yu Ding