DTX3L Polyclonal antibody

• 

  WB analysis of MCF-7 using 11963-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 11963-1-AP (DTX3L antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 11963-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DTX3L Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11963-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

Protein deltex 3 like, EC:2.3.2.27, E3 ubiquitin-protein ligase DTX3L, deltex 3 like (Drosophila), B-lymphoma- and BAL-associated protein

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

11963-1-AP targets DTX3L in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2568

  Product name: Recombinant human DTX3L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 430-741 aa of BC060509

  Sequence: SVHAYASFIDAFQHASCQLMREVLLLKSLGKERKHLHQTKFADDFRKRHPNVHFVLNQESMTLTGLPNHLAKAKQYVLKGGGMSSLAGKKLKEGHETPMDIDSDDSKAASPPLKGSVSSEASELDKKEKGICVICMDTISNKKVLPKCKHEFCAPCINKAMSYKPICPTCQTSYGIQKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQRTAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYGYPDPSYLKRVKEELKAKGIE

• Full Name: deltex 3-like (Drosophila)
• Calculated Molecular Weight: 740 aa, 84 kDa
• Observed Molecular Weight: 84 kDa
• GenBank Accession Number: BC060509
• Gene Symbol: DTX3L
• Gene ID (NCBI): 151636
• RRID: AB_874119
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDB6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Sci; Ubiquitination of NOTCH2 by DTX3 suppresses the proliferation and migration of human esophageal carcinoma.; Authors - Xin-Yu Ding
goat	IHC	Biomolecules; Differential MicroRNA Expression Involved in Endometrial Receptivity of Goats.; Authors - Xupeng Zang
human	WB	Cancer Cell Int; Circular RNA circEYA3 promotes the radiation resistance of hepatocellular carcinoma via the IGF2BP2/DTX3L axis; Authors - Pan Hu