KD/KO Validated

DTX3L Polyclonal antibody

DTX3L Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11963-1-AP

Publications (6)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

BBAP, B-lymphoma- and BAL-associated protein, deltex 3 like (Drosophila), E3 ubiquitin-protein ligase DTX3L, EC:2.3.2.27

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of MCF-7 using 11963-1-AP
MCF-7 cells were subjected to SDS PAGE followed by western blot with 11963-1-AP (DTX3L antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of U2OS using 11963-1-AP
WB result of DTX3L antibody (11963-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DTX3L transfected U2OS cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 11963-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 11963-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 11963-1-AP
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 11963-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 11963-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat lung using 11963-1-AP
Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat ovary using 11963-1-AP
Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 11963-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat ovary using 11963-1-AP
Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 11963-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 11963-1-AP (DTX3L antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DTX3L in ?

Overview

Tested Applications
Product Information
Publications (6)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	MCF-7 cells, U2OS cells
Positive IHC detected in	human ovary cancer tissue, mouse lung tissue, rat kidney tissue, rat ovary tissue, mouse ovary tissue, rat lung tissue, human tonsillitis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11963-1-AP targets DTX3L in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, goat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2568 Product name: Recombinant human DTX3L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 430-741 aa of BC060509 Sequence: SVHAYASFIDAFQHASCQLMREVLLLKSLGKERKHLHQTKFADDFRKRHPNVHFVLNQESMTLTGLPNHLAKAKQYVLKGGGMSSLAGKKLKEGHETPMDIDSDDSKAASPPLKGSVSSEASELDKKEKGICVICMDTISNKKVLPKCKHEFCAPCINKAMSYKPICPTCQTSYGIQKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQRTAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYGYPDPSYLKRVKEELKAKGIE Predict reactive species
Full Name	deltex 3-like (Drosophila)
Calculated Molecular Weight	740 aa, 84 kDa
Observed Molecular Weight	84 kDa
GenBank Accession Number	BC060509
Gene Symbol	DTX3L
Gene ID (NCBI)	151636
RRID	AB_874119
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8TDB6
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for DTX3L antibody 11963-1-AP	Download protocol
WB protocol for DTX3L antibody 11963-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-DTX3L antibody (Cat# 11963-1-AP) has 6 total citations. These appear in International Journal of Biological Macromolecules, Cancer Cell International, Biomolecules, Scientific Reports, and Cancer Science. The research fields span breast cancer progression, hepatocellular carcinoma radiation resistance, endometrial receptivity in goats, pan-cancer prognostic biomarker analysis, esophageal carcinoma proliferation suppression, and ovarian cancer cisplatin resistance. Applications include WB and IHC.

Species	Application	Title
human	IHC	Int J Biol Macromol E3 ubiquitin ligase DTX3L promotes breast cancer progression by enhancing PKCα ubiquitination and inhibiting the p38 MAPK signaling pathway. Authors - Xiaoxiao Zhang View Article
human	WB	Cancer Cell Int Circular RNA circEYA3 promotes the radiation resistance of hepatocellular carcinoma via the IGF2BP2/DTX3L axis Authors - Pan Hu View Article
goat	IHC	Biomolecules Differential MicroRNA Expression Involved in Endometrial Receptivity of Goats. Authors - Xupeng Zang View Article
human	WB,IHC	Sci Rep Pan-cancer analysis of DTX3L as a potential prognostic and immunological biomarker. Authors - Yunfeng Zhang KD Validated View Article
human	WB	Sci Rep DTX3L promotes ovarian cancer progression and cisplatin resistance by activating JAK1/STAT1/OAS3 pathway. Authors - Fangfang Lu KD Validated View Article
human	WB	Cancer Sci Ubiquitination of NOTCH2 by DTX3 suppresses the proliferation and migration of human esophageal carcinoma. Authors - Xin-Yu Ding View Article