DUSP14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DUSP14 Polyclonal antibody (10172-2-AP)

DUSP14 Polyclonal Antibody for WB, ELISA

Cat No. 10172-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

Dual specificity protein phosphatase 14, DUSP 14, EC:3.1.3.16, MAP kinase phosphatase 6, Mitogen-activated protein kinase phosphatase 6

• 

  WB analysis using 10172-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10172-2-AP (DUSP14 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HaCaT cells, rat skin tissue, human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10172-2-AP targets DUSP14 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0228

  Product name: Recombinant human DUSP14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC004448

  Sequence: MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI

• Full Name: dual specificity phosphatase 14
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC004448
• Gene Symbol: DUSP14
• Gene ID (NCBI): 11072
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95147
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DUSP14, also known as dual specificity phosphatase 14, is a member of the dual-specificity phosphatase (DUSP) family, which belongs to the type I cysteine-based protein-tyrosine phosphatase superfamily. The primary function of DUSP14 is the inactivation of mitogen-activated protein kinases (MAPKs). It achieves this by dephosphorylating both the threonine and tyrosine residues within the conserved Thr-Xaa-Tyr motif found in the activation loop of its substrates. Beyond its role as a MAPK phosphatase, DUSP14 is known to directly interact with and dephosphorylate the TGF-beta-activated kinase 1 (TAK1)-binding protein 1 (TAB1) in T cells, which negatively regulates T-cell receptor signaling and immune responses