DUSP19 Polyclonal antibody

• 

  WB analysis of mouse uterus using 12924-1-AP

  mouse uterus tissue were subjected to SDS PAGE followed by western blot with 12924-1-AP (DUSP19 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 12924-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12924-1-AP (DUSP19 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 12924-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12924-1-AP (DUSP19 antibody) at dilution of 1:100 (under 10x lens).

• Featured Product
• KD/KO Validated

DUSP19 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12924-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

DUSP17, DUSP19, LMW DSP3, LMWDSP3, Protein phosphatase SKRP1, SKRP1, TS DSP1

---

Tested Applications

• Positive WB detected in: mouse uterus tissue, mouse lung tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IP: See 1 publications below

Product Information

12924-1-AP targets DUSP19 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3611

  Product name: Recombinant human DUSP19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC035000

  Sequence: MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS

• Full Name: dual specificity phosphatase 19
• Calculated Molecular Weight: 217 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC035000
• Gene Symbol: DUSP19
• Gene ID (NCBI): 142679
• RRID: AB_2094871
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WTR2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IP	Cell Death Differ; The Smad4-MYO18A-PP1A complex regulates β-catenin phosphorylation and pemigatinib resistance by inhibiting PAK1 in cholangiocarcinoma.; Authors - Jialiang Liu
mouse	WB	Addict Biol; Dual-specificity phosphatase 15 (DUSP15) in the nucleus accumbens is a novel negative regulator of morphine-associated contextual memory.; Authors - Xiaomeng Qiao
mouse	WB	Neurol Res; DUSP19 mediates spinal cord injury-induced apoptosis and inflammation in mouse primary microglia cells via the NF-kB signaling pathway.; Authors - Xian-Kuan Xie ; KD Validated