DUSP19 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86354-1-RR (same clone as 86354-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86354-1-RR (DUSP19 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86354-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 86354-1-RR (same clone as 86354-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 86354-1-RR (DUSP19 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86354-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86354-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86354-1-RR against Human DUSP19 were performed. The affinity constant is below 1 pM.

DUSP19 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86354-1-PBS

Clone No.251021A12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Dual specificity phosphatase TS-DSP1, DUSP17, EC:3.1.3.16, LMW DSP3, LMWDSP3

---

Product Information

86354-1-PBS targets DUSP19 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3611

  Product name: Recombinant human DUSP19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC035000

  Sequence: MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS

• Full Name: dual specificity phosphatase 19
• Calculated Molecular Weight: 217 aa, 24 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC035000
• Gene Symbol: DUSP19
• Gene ID (NCBI): 142679
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WTR2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DUSP19 (Dual-Specificity Phosphatase 19), also known as SKRP1, LMW-DSP3, or SAPK pathway-regulating phosphatase 1, is a low-molecular-weight member of the dual-specificity phosphatase family. It is encoded on human chromosome 2q32 and expressed in multiple tissues, with the highest levels found in the pancreas and heart. Structurally, DUSP19 contains a conserved catalytic domain that removes phosphate groups from both phospho-tyrosine and phospho-serine/threonine residues, enabling it to negatively or positively regulate MAPK signaling.