DUSP22 Monoclonal antibody, PBS Only

• 

  WB analysis using 68032-1-Ig (same clone as 68032-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68032-1-Ig (DUSP22 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68032-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit brain using 68032-1-Ig (same clone as 68032-1-PBS)

  rabbit brain tissue were subjected to SDS PAGE followed by western blot with 68032-1-Ig (DUSP22 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68032-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 68032-1-Ig (same clone as 68032-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed NIH/3T3 cells using DUSP22 antibody (68032-1-Ig, Clone: 3B8F1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68032-1-PBS in a different storage buffer formulation.

DUSP22 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68032-1-PBS

Clone No.3B8F1

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat, Rabbit

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

DUSP22, FLJ35864, JKAP, JNK stimulatory phosphatase 1, JSP 1, JSP1, LMW DSP2, LMWDSP2, MAP kinase phosphatase x, MKP x, MKPX, VHX

---

Product Information

68032-1-PBS targets DUSP22 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit samples.

• Tested Reactivity: Human, Mouse, Rat, Rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9831

  Product name: Recombinant human DUSP22 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-184 aa of BC022847

  Sequence: MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL

• Full Name: dual specificity phosphatase 22
• Calculated Molecular Weight: 184 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC022847
• Gene Symbol: DUSP22
• Gene ID (NCBI): 56940
• RRID: AB_2918774
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NRW4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DUSP22(Dual specificity protein phosphatase 22) is also named as JSP1, LMWDSP2, MKPX. It has been demonstrated to belong to a new subgroup of small DSPs anchored at the membranes by an N-terminal myristic acid moiety and DUSP22 play a regulatory role in the JNK or p38 MAPK pathways(PMID:17384676). It has 2 isoforms produced by alternative splicing with the molecular weight of 21 kDa and 23 kDa.