DUSP26 Polyclonal antibody

• 

  WB analysis using 15568-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15568-1-AP (DUSP26 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

DUSP26 Polyclonal Antibody for ELISA

Cat No. 15568-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

DSP 4, DUSP24, DUSP26, LDP 4, LDP4, MAP kinase phosphatase 8, MKP 8, MKP8, NATA1, SKRP3

---

Tested Applications

• Positive WB detected in: mouse retina tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15568-1-AP targets DUSP26 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7831

  Product name: Recombinant human DUSP26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-211 aa of BC001613

  Sequence: MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA

• Full Name: dual specificity phosphatase 26 (putative)
• Calculated Molecular Weight: 24 kDa
• GenBank Accession Number: BC001613
• Gene Symbol: DUSP26
• Gene ID (NCBI): 78986
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BV47
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.