DUSP3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DUSP3 Polyclonal antibody (28284-1-AP)

• Featured Product
• KD/KO Validated

DUSP3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28284-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

VHR, Vaccinia H1-related phosphatase, EC:3.1.3.16, dual specificity phosphatase 3

• 

  WB analysis using 28284-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28284-1-AP (DUSP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 28284-1-AP

  WB result of DUSP3 antibody (28284-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-DUSP3 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 28284-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28284-1-AP (DUSP3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HeLa cells, rat brain tissue
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28284-1-AP targets DUSP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28575

  Product name: Recombinant human DUSP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-185 aa of BC002682

  Sequence: MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

• Full Name: dual specificity phosphatase 3
• Calculated Molecular Weight: 185 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC002682
• Gene Symbol: DUSP3
• Gene ID (NCBI): 1845
• RRID: AB_2918154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51452
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Immun Inflamm Dis; Dehydroandrographolide facilitates M2 macrophage polarization by downregulating DUSP3 to inhibit sepsis-associated acute kidney injury; Authors - Yanyan Shao
		Toxicol Appl Pharmacol; Gastrodin inhibits the dephosphorylation of EGFR by DUSP3 to suppress oxidative stress-induced ferroptosis in astrocytes and alleviate cerebral ischemia-reperfusion injury.; Authors - Jiang Luo
human	WB	Int J Nanomedicine; USC-Derived Small Extracellular Vesicles-Functionalized Scaffolds Promote Scarless Vaginal Defect Repair via Delivery of Decorin and DUSP3 Proteins; Authors - Yiyun Xu
human	WB	Tissue Cell; Targeting DUSP3 promotes cell senescence by activating the notch1 pathway to treat hepatocellular carcinoma; Authors - Wen-Jun Zhang ; KD Validated
mouse	WB	Sci Rep; Piezo1 activation protects against sepsis-induced myocardial dysfunction in a pilot study; Authors - Angwei Gong