DUT Polyclonal antibody

• 

  WB analysis using 13740-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13740-1-AP (DUT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 13740-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13740-1-AP (DUT antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 13740-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13740-1-AP (DUT antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 13740-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 13740-1-AP (DUT antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 13740-1-AP

  IP result of anti-DUT (IP:13740-1-AP, 4ug; Detection:13740-1-AP 1:800) with HEK-293 cells lysate 1440 ug.

• 

  IHC staining of human heart using 13740-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13740-1-AP (DUT Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human heart using 13740-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13740-1-AP (DUT Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HeLa using 13740-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DUT antibody (13740-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

DUT Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13740-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial, deoxyuridine triphosphatase, dUTPase, EC:3.6.1.23

---

Tested Applications

• Positive WB detected in: HeLa cells, human liver tissue, human kidney tissue, HEK-293 cells, Ramos cells, A549 cells, HepG2 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

13740-1-AP targets DUT in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4677

  Product name: Recombinant human DUT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of BC033645

  Sequence: MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

• Full Name: deoxyuridine triphosphatase
• Calculated Molecular Weight: 252 aa, 27 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC033645
• Gene Symbol: DUT
• Gene ID (NCBI): 1854
• RRID: AB_2093170
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P33316
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Cell Metab; Malic enzyme 2 connects the Krebs cycle intermediate fumarate to mitochondrial biogenesis.; Authors - Yi-Ping Wang
human	WB	Cell Chem Biol; CETSA interaction proteomics define specific RNA-modification pathways as key components of fluorouracil-based cancer drug cytotoxicity.; Authors - Ying Yu Liang
human	WB	Bioconjug Chem; ATP-Linked Chimeric Nucleotide as a Specific Luminescence Reporter of Deoxyuridine Triphosphatase.; Authors - Debin Ji
human	WB,IF	Biochem Genet; Identification of a Novel Mitochondrial-Related Gene Signature for BMSCs in Osteoporosis Combining Single-Cell and Bulk Transcriptome Data; Authors - Jishi Jiang