DYDC2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DYDC2 Polyclonal antibody, PBS Only (25568-1-PBS)

• 

  WB analysis using 25568-1-AP (same clone as 25568-1-PBS)

  pig oviduct tissue were subjected to SDS PAGE followed by western blot with 25568-1-AP (DYDC2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25568-1-PBS in a different storage buffer formulation.

DYDC2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25568-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, pig

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25568-1-PBS targets DYDC2 in WB, Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22250

  Product name: Recombinant human DYDC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-177 aa of BC007374

  Sequence: METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF

• Full Name: DPY30 domain containing 2
• Calculated Molecular Weight: 177 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC007374
• Gene Symbol: DYDC2
• Gene ID (NCBI): 84332
• RRID: AB_3669486
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96IM9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.