DYNC1LI1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DYNC1LI1 Polyclonal antibody, PBS Only (25326-1-PBS)

• 

  WB analysis of K-562 using 25326-1-AP (same clone as 25326-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 25326-1-AP (DYNC1LI1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25326-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 25326-1-AP (same clone as 25326-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25326-1-AP (DYNC1LI1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25326-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 25326-1-AP (same clone as 25326-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 25326-1-AP (DYNC1LI1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25326-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 25326-1-AP (same clone as 25326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 25326-1-AP (DYNC1LI1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25326-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 25326-1-AP (same clone as 25326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 25326-1-AP (DYNC1LI1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25326-1-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 25326-1-AP (same clone as 25326-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using DYNC1LI1 antibody (25326-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 25326-1-PBS in a different storage buffer formulation.

DYNC1LI1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25326-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

25326-1-PBS targets DYNC1LI1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18191

  Product name: Recombinant human DYNC1LI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 167-233 aa of BC131620

  Sequence: SVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLT

• Full Name: dynein, cytoplasmic 1, light intermediate chain 1
• Calculated Molecular Weight: 523 aa, 57 kDa
• Observed Molecular Weight: 57-60 kDa
• GenBank Accession Number: BC131620
• Gene Symbol: DYNC1LI1
• Gene ID (NCBI): 51143
• RRID: AB_2880031
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6G9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.