CoraLite®594-conjugated DYNC2H1 Polyclonal antibody

DYNC2H1 Polyclonal Antibody for IF/ICC
Cat No. CL594-29758

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

DHC1b, DHC2, DNCH2, DYH1B, hdhc11

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inhTERT-RPE1 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-29758 targets DYNC2H1 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30707

Product name: Recombinant human DYNC2H1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 42-196 aa of NM_001377

Sequence: FLDDGNQMLLRVQRSDAGISFSNTIEFGDTKDKVLVFFKLRPEVITDENLHDNILVSSMLESPISSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRRSDTNLTKLKFKEDDTRGILTPSDEFQFWIEQAHRGNKQISKERAN

Predict reactive species
Full Name dynein, cytoplasmic 2, heavy chain 1
Calculated Molecular Weight 493 kDa
Observed Molecular Weight493 kDa
GenBank Accession NumberNM_001377
Gene Symbol DYNC2H1
Gene ID (NCBI) 79659
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NCM8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DYNC2H1 (Cytoplasmic dynein 2 heavy chain 1) is involved in ciliary intraflagellar transport (IFT). DYNC2H1 drives retrograde transport of the IFT-A protein complex that regulates tip-to-base transport in cilia, involved in the generation and maintenance of cilia. DYNC2H1 variants or retina-predominant variants cause nonsyndromic retinal degeneration (PMID:32753734). DYNC2H1 mutations also cause asphyxiating thoracic dystrophy and short rib-polydactyly syndrome (PMID: 19442771). DYNC2H1 was localized to the basal bodies by immunofluorescence staining (PMID: 21552265, PMID: 26077881, PMID: 30320547).

Protocols

Product Specific Protocols
IF protocol for CL594 DYNC2H1 antibody CL594-29758Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...