DYNC2H1 Polyclonal antibody

• 

  WB analysis of mouse testis using 29758-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 29758-1-AP (DYNC2H1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 29758-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 29758-1-AP (DYNC2H1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 29758-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 29758-1-AP (DYNC2H1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse small intestine using 29758-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 29758-1-AP (DYNC2H1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of hTERT-RPE1 using 29758-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using DYNC2H1 antibody (29758-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite® Plus 488 ARL13B antibody (CL488-17711, green).

• 

  IF Staining of hTERT-RPE1 using 29758-1-AP

  Immunofluorescent analysis of (4% PFA) fixed hTERT-RPE1 cells using DYNC2H1 antibody (29758-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite® Plus 488 ARL13B antibody (CL488-17711, green).

DYNC2H1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29758-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DHC1b, DHC2, DNCH2, DYH1B, hdhc11

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: mouse kidney tissue, mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29758-1-AP targets DYNC2H1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30707

  Product name: Recombinant human DYNC2H1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 42-196 aa of NM_001377

  Sequence: FLDDGNQMLLRVQRSDAGISFSNTIEFGDTKDKVLVFFKLRPEVITDENLHDNILVSSMLESPISSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRRSDTNLTKLKFKEDDTRGILTPSDEFQFWIEQAHRGNKQISKERAN

• Full Name: dynein, cytoplasmic 2, heavy chain 1
• Calculated Molecular Weight: 493 kDa
• Observed Molecular Weight: 493 kDa
• GenBank Accession Number: NM_001377
• Gene Symbol: DYNC2H1
• Gene ID (NCBI): 79659
• RRID: AB_2935476
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NCM8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DYNC2H1 (Cytoplasmic dynein 2 heavy chain 1) is involved in ciliary intraflagellar transport (IFT). DYNC2H1 drives retrograde transport of the IFT-A protein complex that regulates tip-to-base transport in cilia, involved in the generation and maintenance of cilia. DYNC2H1 variants or retina-predominant variants cause nonsyndromic retinal degeneration (PMID:32753734). DYNC2H1 mutations also cause asphyxiating thoracic dystrophy and short rib-polydactyly syndrome (PMID: 19442771). DYNC2H1 was localized to the basal bodies by immunofluorescence staining (PMID: 21552265, PMID: 26077881, PMID: 30320547).