DYNLL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DYNLL2 Polyclonal antibody (16811-1-AP)

DYNLL2 Polyclonal Antibody for WB, ELISA

Cat No. 16811-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

8 kDa dynein light chain b, Dlc2, DLC8b, DNCL1B, Dynein light chain LC8 type 2, DYNLL2

• 

  WB analysis using 16811-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16811-1-AP (DYNLL2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 16811-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 16811-1-AP (DYNLL2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 16811-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 16811-1-AP (DYNLL2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DYNLL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, human heart tissue, mouse brain tissue, rat brain tisssue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16811-1-AP targets DYNLL2 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10345

  Product name: Recombinant human DYNLL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-89 aa of BC010744

  Sequence: MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

• Full Name: dynein, light chain, LC8-type 2
• Calculated Molecular Weight: 89 aa, 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC010744
• Gene Symbol: DYNLL2
• Gene ID (NCBI): 140735
• RRID: AB_2093667
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96FJ2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The DYNLL2 polyclonal antibody (Cat# 16811-1-AP) has 14 citations spanning journals including Science, Current Biology, Cell Reports, eLife, Development, Analytical Chemistry, Cell Cycle, Frontiers in Oncology, Asian Journal of Andrology, Biochemical Pharmacology, Cellular and Molecular Life Sciences, Scientific Reports, Biochimica et Biophysica Acta, and International Journal of Biological Sciences. Research fields include cilia/flagella biogenesis, sperm motility and male infertility, microtubule dynamics, protein-protein interactions, pyroptosis in sepsis, and osteosarcoma biomarkers.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Int J Biol Sci; Identification and Functional Characterization of a New Splicing Variant of EZH2 in the Central Nervous System.; Authors - Danyang Li
mouse	WB	Curr Biol; CCDC176 stabilizes microtubule doublets 1 and 9 to ensure proper sperm movement; Authors - Chao Liu
mouse	IF	Cell Rep; Differential requirements of IQUB for the assembly of radial spoke 1 and the motility of mouse cilia and flagella; Authors - Xin Zhang
human	WB	Anal Chem; Ionic Liquid-Based Extraction System for In-Depth Analysis of Membrane Protein Complexes.; Authors - Hongwei Chu
mouse	WB	Cell Mol Life Sci; CCDC146 is required for sperm flagellum biogenesis and male fertility in mice; Authors - Yanjie Ma
mouse	WB,CoIP	Biochem Pharmacol; Targeting the DYNLL2-PAK1 axis inhibits caspase-11-dependent pyroptosis to alleviate sepsis.; Authors - Chen Zhou ; KD Validated