DYRK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DYRK2 Polyclonal antibody, PBS Only (21979-1-PBS)

• 

  WB analysis using 21979-1-AP (same clone as 21979-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21979-1-AP (DYRK2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21979-1-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 21979-1-AP (same clone as 21979-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using DYRK2 antibody (21979-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 21979-1-PBS in a different storage buffer formulation.

DYRK2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 21979-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Dual specificity tyrosine-phosphorylation-regulated kinase 2, DYRK 2, EC:2.7.12.1

---

Product Information

21979-1-PBS targets DYRK2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13480

  Product name: Recombinant human DYRK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC006375

  Sequence: MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNAAAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT

• Full Name: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 67~70 kDa
• GenBank Accession Number: BC006375
• Gene Symbol: DYRK2
• Gene ID (NCBI): 8445
• RRID: AB_3742061
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92630
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DYRK (Dual-specificity tyrosine phosphorylation-regulated kinase 2) is the only member of the Dual-specificity tYrosine phosphorylation-Regulated Kinase (DYRK) family that functions as a kinase activity-independent scaffold for an E3 ubiquitin ligase complex (PMID: 33376136). DYRK2 is involved in cell survival, development, differentiation, gene transcription, proteasomal regulation, and microtubule formation. DYRK2 is a key regulator of cell cycle and apoptosis in response to DNA damage via phosphorylation of p53. DYRK2 has two isoforms and is mostly localized in the cytoplasm; however, it accumulates in the nucleus under genotoxic stress conditions (PMID: 31505048, 37886981).