DYRK3 Polyclonal antibody

• 

DYRK3 Polyclonal Antibody for ELISA

Cat No. 14334-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

DYRK3, DYRK5, hYAK3 2, RED, REDK, Regulatory erythroid kinase

---

Product Information

14334-1-AP targets DYRK3 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5620

  Product name: Recombinant human DYRK3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 219-568 aa of BC015501

  Sequence: MVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVHKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS

• Full Name: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
• Calculated Molecular Weight: 66 kDa
• GenBank Accession Number: BC015501
• Gene Symbol: DYRK3
• Gene ID (NCBI): 8444
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43781
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.