DcR1/TNFRSF10C Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86886-1-RR (same clone as 86886-1-PBS)

  Human placenta tissue lysate was subjected to SDS PAGE followed by western blot with 86886-1-RR (DcR1/TNFRSF10C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86886-1-PBS in a different storage buffer formulation.

• 

  WB analysis of JAR using 86886-1-RR (same clone as 86886-1-PBS)

  JAR cells lysate was subjected to SDS PAGE followed by western blot with 86886-1-RR (DcR1/TNFRSF10C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86886-1-PBS in a different storage buffer formulation.

DcR1/TNFRSF10C Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86886-1-PBS

Clone No.251096G6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

DcR1, Antagonist decoy receptor for TRAIL/Apo-2L, CD263, Decoy receptor 1, LIT

---

Product Information

86886-1-PBS targets DcR1/TNFRSF10C in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4677

  Product name: recombinant human TRAIL R3/TNFRSF10C protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 26-235 aa of NM_003841.5

  Sequence: ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTP

• Full Name: tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 60-75 kDa
• GenBank Accession Number: NM_003841.5
• Gene Symbol: DcR1
• Gene ID (NCBI): 8794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14798
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Decoy receptor 1 (DcR1), also known as TNFRSF10C, CD263, TRAIL-R3, or TRID, is a member of the TNF-receptor superfamily. DcR1 is a receptor for the cytotoxic ligand TRAIL. In contrast to DR4/TRAIL-R1 and DR5/TRAIL-R2, DcR1 is a glycosylphosphatidylinositol (GPI)-linked membrane molecule that lacks a cytoplasmic region, including the death domain (PMID: 9314565; 9242611). DcR1 is not capable of inducing apoptosis and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis (PMID: 9242610). The apparent molecular weight of DcR1 is larger than the calculated molecular weight of 27 kDa, suggesting the presence of extensive post-translational modifications and/or unusual structural motifs (PMID: 9373179).