Mouse Decorin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85737-4-RR (same clone as 85737-4-PBS)

  Tissue were subjected to SDS PAGE followed by western blot with 85737-4-RR (Dcn antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85737-4-PBS in a different storage buffer formulation.

Decorin Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85737-4-PBS

Clone No.250099C3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Bone proteoglycan II, Dcn, PG40, PG-S2

---

Product Information

85737-4-PBS targets Decorin in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2955

  Product name: Recombinant Mouse Decorin protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 17-354 aa of NM_001190451.2

  Sequence: GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK

• Full Name: decorin
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 45-100 kDa
• GenBank Accession Number: NM_001190451.2
• Gene Symbol: Dcn
• Gene ID (NCBI): 13179
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28654
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Decorin is a member of the small leucine-rich proteoglycan family of proteins. Decorin interacts with type I collagen fibrils, thereby influencing the kinetics of fibril formation and the distance between adjacent collagen fibrils. The binding of this protein to multiple cell surface receptors mediates its role in tumor suppression, including a stimulatory effect on autophagy and inflammation and an inhibitory effect on angiogenesis and tumorigenesis. Decorin(~ 40 kDa) also binds glycosaminoglycan chains to form big molecules.