Desmin Monoclonal antibody, PBS Only

• 

  WB analysis using 67793-1-Ig (same clone as 67793-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67793-1-Ig (Desmin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 67793-1-Ig (same clone as 67793-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 67793-1-Ig (Desmin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 67793-1-Ig (same clone as 67793-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 67793-1-Ig (Desmin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 67793-1-Ig (same clone as 67793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 67793-1-Ig (Desmin antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 67793-1-Ig (same clone as 67793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67793-1-Ig (Desmin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 67793-1-Ig (same clone as 67793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67793-1-Ig (Desmin antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human rectal cancer using 67793-1-Ig (same clone as 67793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 67793-1-Ig (Desmin antibody) at dilution of 1:2000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 67793-1-Ig (same clone as 67793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 67793-1-Ig (Desmin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 67793-1-Ig (same clone as 67793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 67793-1-Ig (Desmin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 67793-1-Ig (same clone as 67793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67793-1-Ig (Desmin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human colon using 67793-1-Ig (same clone as 67793-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human colon tissue using Desmin antibody (67793-1-Ig, Clone: 2B1A11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). DAPI (blue). This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human appendicitis using 67793-1-Ig (same clone as 67793-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human appendicitis tissue using Desmin antibody (67793-1-Ig, Clone: 2B1A11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse skeletal muscle using 67793-1-Ig (same clone as 67793-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using Desmin antibody (67793-1-Ig, Clone: 2B1A11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67793-1-PBS in a different storage buffer formulation.

Desmin Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67793-1-PBS

Clone No.2B1A11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

2B1A11, DES

---

Product Information

67793-1-PBS targets Desmin in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9675

  Product name: Recombinant human Desmin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 121-470 aa of BC032116

  Sequence: NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

• Full Name: desmin
• Calculated Molecular Weight: 470 aa, 54 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC032116
• Gene Symbol: Desmin
• Gene ID (NCBI): 1674
• RRID: AB_2918557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P17661
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Desmin is the main intermediate filament protein in skeletal and cardiac muscle cells and is essential for both the structural integrity and the survival of muscle cells. As an abundant muscle-specific protein, desmin has been widely used as a marker of muscle derived tumors. Anti-desmin is also valuable in the differential diagnosis of tumors of uncertain origin.