Destrin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Destrin Polyclonal antibody, PBS Only (10962-2-PBS)

• 

  WB analysis using 10962-2-AP (same clone as 10962-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10962-2-AP (Destrin antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10962-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 10962-2-AP (same clone as 10962-2-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 10962-2-AP (Destrin antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10962-2-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 10962-2-AP (same clone as 10962-2-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using Destrin antibody (10962-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10962-2-PBS in a different storage buffer formulation.

Destrin Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10962-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DSTN, DSN, ADF, Actin-depolymerizing factor, ACTDP

---

Product Information

10962-2-PBS targets Destrin in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1402

  Product name: Recombinant human DSTN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC009477

  Sequence: MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV

• Full Name: destrin (actin depolymerizing factor)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC009477
• Gene Symbol: Destrin
• Gene ID (NCBI): 11034
• RRID: AB_2230671
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60981
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Destrin (also known as actin depolymerization factor, ADF) is an actin-binding protein contributing to cytoskeletal dynamics by promoting rapid actin filament disassembly. By regulating actin cytoskeletal reorganization it plays an important role in the formation of filopodia, which further promotes tumor cell invasion and metastasis. Destrin has been reported to be overexpressed in primary colon cancer.