Product Information
25010-1-PBS targets Dexras1 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18818 Product name: Recombinant human RASD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 145-250 aa of BC018041 Sequence: NKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFA Predict reactive species |
| Full Name | RAS, dexamethasone-induced 1 |
| Calculated Molecular Weight | 281 aa, 32 kDa |
| GenBank Accession Number | BC018041 |
| Gene Symbol | Dexras1 |
| Gene ID (NCBI) | 51655 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y272 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
