Dysadherin Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Dysadherin Recombinant monoclonal antibody, PBS Only (85025-6-PBS)

• 

  WB analysis using 85025-6-RR (same clone as 85025-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85025-6-RR (FXYD5/Dysadherin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85025-6-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 85025-6-RR (same clone as 85025-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using Dysadherin antibody (85025-6-RR, Clone: 252907A7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85025-6-PBS in a different storage buffer formulation.

• 

  Affinity of 85025-6-RR

  Biolayer interferometry (BLl) kinetic assays of 85025-6-RR against Human Dysadherin were performed. The affinity constant is 13.5 nM.

Dysadherin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85025-6-PBS

Clone No.252907A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FXYD5, DYSAD, FXYD domain-containing ion transport regulator 5, HSPC113, IWU 1

---

Product Information

85025-6-PBS targets Dysadherin in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5715

  Product name: Recombinant human FXYD5/Dysadherin protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-145 aa of NM_001164605.2

  Sequence: QTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKR

• Full Name: FXYD domain containing ion transport regulator 5
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 35-55 kDa
• GenBank Accession Number: NM_001164605.2
• Gene Symbol: Dysadherin
• Gene ID (NCBI): 53827
• RRID: AB_3743948
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96DB9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Dysadherin (also known as FXYD5) is a cancer-related transmembrane glycoprotein, belonging to FXYD family. It is overexpressed on the surface of many tumor cells, and promotes the movement, migration and metastasis of tumor cells by reducing E-cadherin(E- cadherin) dependent intercellular adhesion. Its main function also includes regulating the activity of na, k-ATPase. It is also a typical "abnormal migration" protein-its SDS-PAGE apparent molecular weight (35-55 kDa) is much higher than the theoretical calculation value (~20 kDa). This difference is mainly caused by extensive O- glycosylation modification, which is particularly important in cancer research, because tumor cells often show a higher degree of glycosylation (50-55 kDa), which may be related to their metastasis promoting function(PMID: 17442482;41535258).