Dysadherin Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Dysadherin Recombinant monoclonal antibody (85025-6-RR)

• 

  WB analysis using 85025-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85025-6-RR (FXYD5/Dysadherin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Jurkat using 85025-6-RR

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using Dysadherin antibody (85025-6-RR, Clone: 252907A7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity of 85025-6-RR

  Biolayer interferometry (BLl) kinetic assays of 85025-6-RR against Human Dysadherin were performed. The affinity constant is 13.5 nM.

Dysadherin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 85025-6-RR

Clone No.252907A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

FXYD5, DYSAD, FXYD domain-containing ion transport regulator 5, HSPC113, IWU 1

---

Tested Applications

• Positive WB detected in: PC-3 cells, MDA-MB-231 cells, NCI-H1299 cells
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85025-6-RR targets Dysadherin in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5715

  Product name: Recombinant human FXYD5/Dysadherin protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-145 aa of NM_001164605.2

  Sequence: QTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKR

• Full Name: FXYD domain containing ion transport regulator 5
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 35-55 kDa
• GenBank Accession Number: NM_001164605.2
• Gene Symbol: Dysadherin
• Gene ID (NCBI): 53827
• RRID: AB_3743948
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96DB9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Dysadherin (also known as FXYD5) is a cancer-related transmembrane glycoprotein, belonging to FXYD family. It is overexpressed on the surface of many tumor cells, and promotes the movement, migration and metastasis of tumor cells by reducing E-cadherin(E- cadherin) dependent intercellular adhesion. Its main function also includes regulating the activity of na, k-ATPase. It is also a typical "abnormal migration" protein-its SDS-PAGE apparent molecular weight (35-55 kDa) is much higher than the theoretical calculation value (~20 kDa). This difference is mainly caused by extensive O- glycosylation modification, which is particularly important in cancer research, because tumor cells often show a higher degree of glycosylation (50-55 kDa), which may be related to their metastasis promoting function(PMID: 17442482;41535258).