Tested Applications
| Positive WB detected in | PC-3 cells, MDA-MB-231 cells, NCI-H1299 cells |
| Positive IF/ICC detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85025-6-RR targets Dysadherin in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg5715 Product name: Recombinant human FXYD5/Dysadherin protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 22-145 aa of NM_001164605.2 Sequence: QTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKR Predict reactive species |
| Full Name | FXYD domain containing ion transport regulator 5 |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 35-55 kDa |
| GenBank Accession Number | NM_001164605.2 |
| Gene Symbol | Dysadherin |
| Gene ID (NCBI) | 53827 |
| RRID | AB_3743948 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96DB9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Dysadherin (also known as FXYD5) is a cancer-related transmembrane glycoprotein, belonging to FXYD family. It is overexpressed on the surface of many tumor cells, and promotes the movement, migration and metastasis of tumor cells by reducing E-cadherin(E- cadherin) dependent intercellular adhesion. Its main function also includes regulating the activity of na, k-ATPase. It is also a typical "abnormal migration" protein-its SDS-PAGE apparent molecular weight (35-55 kDa) is much higher than the theoretical calculation value (~20 kDa). This difference is mainly caused by extensive O- glycosylation modification, which is particularly important in cancer research, because tumor cells often show a higher degree of glycosylation (50-55 kDa), which may be related to their metastasis promoting function(PMID: 17442482;41535258).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Dysadherin antibody 85025-6-RR | Download protocol |
| WB protocol for Dysadherin antibody 85025-6-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





