E-selectin / CD62E Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• E-selectin / CD62E Polyclonal antibody, PBS Only (30205-1-PBS)

• 

  IHC staining of human appendicitis using 30205-1-AP (same clone as 30205-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 30205-1-AP (E-selectin / CD62E antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30205-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 30205-1-AP (same clone as 30205-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 30205-1-AP (E-selectin / CD62E antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30205-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human appendicitis using 30205-1-AP (same clone as 30205-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human appendicitis tissue using E-selectin / CD62E antibody (30205-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30205-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human appendicitis using 30205-1-AP (same clone as 30205-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human appendicitis tissue using E-selectin / CD62E antibody (30205-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30205-1-PBS in a different storage buffer formulation.

E-selectin / CD62E Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 30205-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

30205-1-PBS targets E-selectin / CD62E in IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31820

  Product name: Recombinant human SELE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 164-371 aa of BC142711

  Sequence: KCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALS

• Full Name: selectin E
• Calculated Molecular Weight: 610 aa, 67 kDa
• GenBank Accession Number: BC142711
• Gene Symbol: CD62E
• Gene ID (NCBI): 6401
• RRID: AB_2935530
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16581
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

E-selectin, also known as ELAM-1 or CD62E, is a member of the selectin family of adhesion molecules that also includes L-selectin and P-selectin. E-selectin is an inducible endothelial cell surface molecule. Its expression on endothelial cells is transcriptionally upregulated by various proinflammatory substances such as IL-1, TNFα and lipopolysaccharide (LPS). Besides, it can be secreted by endothelial cells, and can be detected in a soluble form (sE-selectin) in serum. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. (PMID: 2827173; 1382417; 8943958)