E2F7 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82887-2-RR (same clone as 82887-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82887-2-RR (E2F7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82887-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 82887-2-RR (same clone as 82887-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82887-2-RR (E2F7 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82887-2-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 82887-2-RR (same clone as 82887-2-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 82887-2-RR (E2F7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82887-2-PBS in a different storage buffer formulation.

E2F7 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 82887-2-PBS

Clone No.230073E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

230073E3, E2F-7, Transcription factor E2F7

---

Product Information

82887-2-PBS targets E2F7 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21599

  Product name: Recombinant human E2F7 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 369-713 aa of BC136366

  Sequence: VDFSSSDEELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERIQRKVNSEPSSPYREEQGSGGYSLEIGSLAAVYRQKIEDNSQGKAFASKRVVPPSSSLDPVAPFPVLSVDPEYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVSLASAASAVESLKPALLAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEERKPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPA

• Full Name: E2F transcription factor 7
• Calculated Molecular Weight: 911 aa, 100 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC136366
• Gene Symbol: E2F7
• Gene ID (NCBI): 144455
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q96AV8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

E2F7, also named E2F transcription factor 7, is a 911 amino acid protein belonging to the E2F/DP family. E2F7 localizes in the nucleus and mainly forms homodimers and, to a lesser extent, heterodimers with E2F8. E2F7 as a transcription factor involves in various processes such as angiogenesis, polyploidization of specialized cells, and DNA damage response. E2F7 mainly forms homodimers and to a lesser extent, heterodimers with E2F8. (PMID: 18194653 )