EAF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EAF2 Polyclonal antibody, PBS Only (11172-1-PBS)

• 

  WB analysis of HEK-293 using 11172-1-AP (same clone as 11172-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11172-1-AP (EAF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11172-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 11172-1-AP (same clone as 11172-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 11172-1-AP (EAF2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11172-1-AP (same clone as 11172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11172-1-AP (EAF2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11172-1-AP (same clone as 11172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11172-1-AP (EAF2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11172-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11172-1-AP (same clone as 11172-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 11172-1-AP (EAF2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11172-1-PBS in a different storage buffer formulation.

EAF2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11172-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

11172-1-PBS targets EAF2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1637

  Product name: Recombinant human EAF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-260 aa of BC014209

  Sequence: MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD

• Full Name: ELL associated factor 2
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC014209
• Gene Symbol: EAF2
• Gene ID (NCBI): 55840
• RRID: AB_2097560
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CJ1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ELL associated factor 1 and ELL associated factor 2 (EAF1/2 factors) are reported to play important roles in tumor suppression and embryogenesis. The tumor suppressor EAF2 is regulated by androgen signaling and associated with prostate cancer. Eaf factors have been revealed to modulate mesoderm and neural patterning by inhibiting canonical Wnt signaling, and high activity of canonical Wnt/β-catenin is revealed in eafs morphants (PMID: 23364330). Catalog#11172-1-AP is a rabbit polyclonal antibody raised against the full-length of human EAF2.