EBF3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EBF3 Polyclonal antibody, PBS Only (21148-1-PBS)

• 

  WB analysis using 21148-1-AP (same clone as 21148-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21148-1-AP (EBF3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21148-1-PBS in a different storage buffer formulation.

EBF3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21148-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

O/E 2, EBF-3, EBF 3, Early B-cell factor 3, early B cell factor 3

---

Product Information

21148-1-PBS targets EBF3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15693

  Product name: Recombinant human EBF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 194-543 aa of BC126130

  Sequence: CNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSMNGYGSGAMASLGVPGSPGFLNGSSANSPYGMKQKSAFAPVVRPQASPPPSCTSANGNGLQAM

• Full Name: early B-cell factor 3
• Calculated Molecular Weight: 596 aa, 65 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC126130
• Gene Symbol: EBF3
• Gene ID (NCBI): 253738
• RRID: AB_10732811
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4W6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.