EBI3/IL-27B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EBI3/IL-27B Polyclonal antibody, PBS Only (12371-1-PBS)

• 

  WB analysis using 12371-1-AP (same clone as 12371-1-PBS)

  human placenta tissue was subjected to SDS PAGE followed by western blot with 12371-1-AP (EBI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12371-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12371-1-AP (same clone as 12371-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12371-1-AP (EBI3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12371-1-PBS in a different storage buffer formulation.

• 

  IP experiment of human placenta using 12371-1-AP (same clone as 12371-1-PBS)

  IP result of anti-EBI3 (IP:12371-1-AP, 4ug; Detection:12371-1-AP 1:800) with human placenta tissue lysate 600 ug. This data was developed using the same antibody clone with 12371-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 12371-1-AP (same clone as 12371-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 12371-1-AP (EBI3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12371-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 12371-1-AP (same clone as 12371-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 12371-1-AP (EBI3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12371-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 12371-1-AP (same clone as 12371-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 12371-1-AP (EBI3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12371-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 12371-1-AP (same clone as 12371-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 12371-1-AP (EBI3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12371-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EBI3/IL-27B Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12371-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, pig

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

EBI3, EBV induced gene 3 protein, EBV-induced gene 3 protein, Epstein Barr virus induced 3, Epstein-Barr virus-induced gene 3 protein

---

Product Information

12371-1-PBS targets EBI3/IL-27B in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3051

  Product name: Recombinant human EBI3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-229 aa of BC015364

  Sequence: MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

• Full Name: Epstein-Barr virus induced 3
• Calculated Molecular Weight: 229 aa, 25 kDa
• Observed Molecular Weight: 25-35 kDa
• GenBank Accession Number: BC015364
• Gene Symbol: EBI3
• Gene ID (NCBI): 10148
• RRID: AB_10646470
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14213
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EBI3, a 34-kDa secreted glycoprotein, is a subunit in 2 distinct heterodimeric cytokines: IL-27 and IL-35. IL-27, composed of p28 (IL-27) and EBI3, can trigger signaling in T cells, B cells, and myeloid cells. IL-35, composed of EBI3 and the ubiquitously expressed p35 subunit of IL-12, is an inhibitory cytokine involved in regulatory T-cell function. EBI3 plays a role in regulating cell-mediated immune responses. (PMID: 8551575; 18033300; 17874423; 21931777)