EBI3/IL-27B Monoclonal antibody

• 

  WB analysis of human spleen using 66354-1-Ig

  human spleen tissue were subjected to SDS PAGE followed by western blot with 66354-1-Ig (EBI3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat spleen using 66354-1-Ig

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 66354-1-Ig (EBI3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

EBI3/IL-27B Monoclonal Antibody for WB, ELISA

Cat No. 66354-1-Ig

Clone No.1F3H10

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, ELISA

Synonyms

EBI3, 1F3H10, EBV induced gene 3 protein, EBV-induced gene 3 protein, Epstein Barr virus induced 3

---

Tested Applications

• Positive WB detected in: human spleen tissue, rat spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66354-1-Ig targets EBI3/IL-27B in WB, ELISA applications and shows reactivity with human, rat, pig samples.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3051

  Product name: Recombinant human EBI3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-229 aa of BC015364

  Sequence: MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

• Full Name: Epstein-Barr virus induced 3
• Calculated Molecular Weight: 229 aa, 25 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC015364
• Gene Symbol: EBI3
• Gene ID (NCBI): 10148
• RRID: AB_2881734
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14213
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EBI3, a 34-kDa secreted glycoprotein, is a subunit in 2 distinct heterodimeric cytokines: IL-27 and IL-35. IL-27, composed of p28 (IL-27) and EBI3, can trigger signaling in T cells, B cells, and myeloid cells. IL-35, composed of EBI3 and the ubiquitously expressed p35 subunit of IL-12, is an inhibitory cytokine involved in regulatory T-cell function. EBI3 plays a role in regulating cell-mediated immune responses. (PMID: 8551575; 18033300; 17874423; 21931777)