ECM1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83067-6-RR (same clone as 83067-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83067-6-RR (ECM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83067-6-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 83067-6-RR (same clone as 83067-6-PBS)

  WB result of ECM1 antibody (83067-6-RR; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-ECM1 transfected A431 cells. This data was developed using the same antibody clone with 83067-6-PBS in a different storage buffer formulation.

• 

  FC experiment of A375 using 83067-6-RR (same clone as 83067-6-PBS)

  1x10^6 A375 cells were intracellularly stained with 0.25 ug Anti-Human ECM1 (83067-6-RR, Clone:230321F12) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83067-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83067-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83067-6-RR against Human ECM1 were performed. The affinity constant is 0.419 nM.

• Featured Product
• KD/KO Validated

ECM1 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 83067-6-PBS

Clone No.230321F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

230321F12, extracellular matrix protein 1, Secretory component p85

---

Product Information

83067-6-PBS targets ECM1 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0533

  Product name: Recombinant Human ECM1 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 20-540 aa of BC023505

  Sequence: ASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGMPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDISRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE

• Full Name: extracellular matrix protein 1
• Calculated Molecular Weight: 540 aa, 61 kDa
• Observed Molecular Weight: 60-80 kDa
• GenBank Accession Number: BC023505
• Gene Symbol: ECM1
• Gene ID (NCBI): 1893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16610
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ECM1 (extracellular matrix protein 1), also known as URBWD. It is located in secreted, extracellular space, and extracellular matrix, which is mainly expressed in esophagus and gall bladder. The gene encodes a soluble protein that is involved in endochondral bone formation, angiogenesis, and tumor biology. It also interacts with a variety of extracellular and structural proteins, contributing to the maintenance of skin integrity and homeostasis. Mutations in this gene are associated with lipoid proteinosis disorder (also known as hyalinosis cutis et mucosae or Urbach-Wiethe disease) that is characterized by generalized thickening of skin, mucosae and certain viscera. The calculated molecular weight of ECM1 is 60 kDa, and this antibody can recognize the 63 kDa isoform of target, moreover, this protein may have glycosylation modification.