ECOP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ECOP Polyclonal antibody (12611-1-AP)

• Featured Product
• KD/KO Validated

ECOP Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12611-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EGFR-coamplified and overexpressed protein, GASP, Glioblastoma-amplified secreted protein, Putative NF-kappa-B-activating protein 055N, VOPP1

• 

  WB analysis of Transfected HEK-293 using 12611-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 12611-1-AP (ECOP Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of A549 using 12611-1-AP

  IP result of anti-ECOP (IP:12611-1-AP, 4ug; Detection:12611-1-AP 1:500) with A549 cells lysate 800 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 12611-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12611-1-AP (ECOP Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 12611-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 12611-1-AP (ECOP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 12611-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 12611-1-AP (ECOP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 12611-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12611-1-AP (ECOP Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Transfected HEK-293 cells
• Positive IP detected in: A549 cells
• Positive IHC detected in: human kidney tissue, mouse ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12611-1-AP targets ECOP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3225

  Product name: Recombinant human ECOP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-172 aa of BC016650

  Sequence: KKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMGVLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQVPPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK

• Full Name: EGFR-coamplified and overexpressed protein
• Calculated Molecular Weight: 172 aa, 19 kDa
• GenBank Accession Number: BC016650
• Gene Symbol: ECOP
• Gene ID (NCBI): 81552
• RRID: AB_2877866
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AW1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ECOP, also named as VOPP1 and GASP, has been previously shown to be over-expressed in human glioblastoma multiforme and squamous cell carcinoma. It interacts directly with cytoplasmic mediators of the NF kappa B pathway. ECOP has three isoforms with MW 18-19 kDa.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IP,IHC,IF	BMC Biol; VOPP1 promotes breast tumorigenesis by interacting with the tumor suppressor WWOX.; Authors - Florian Bonin ; KD Validated
human	IHC	Cell Discov; Integrative clinico-molecular analysis reveals actionable subtypes and biomarkers in lung adenocarcinoma.; Authors - Jun Shang
human	WB	J Inflamm Res; VOPP1 as a Novel Susceptibility Gene in Rheumatoid Arthritis: Insights Into Its Mechanisms From Mendelian Randomization and Experimental Validation.; Authors - Weijie Wu ; KD Validated
mouse	WB	Aging (Albany NY); Plumbagin has an inhibitory effect on the growth of TSCC PDX model and it enhances the anticancer efficacy of cisplatin; Authors - Yuqi Xin
human	WB	Eur J Pharmacol; VOPP1, a Determinant of the Sensitivity of Non-Small Cell Lung Cancer Cells to NAE Inhibitors; Authors - Ru-Jun Xu