EDDM3B Polyclonal antibody

• 

  WB analysis using 32425-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32425-1-AP (EDDM3B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of human testis using 32425-1-AP

  IP result of anti-EDDM3B (IP:32425-1-AP, 4ug; Detection:32425-1-AP 1:500) with human testis tissue lysate 4080 ug.

EDDM3B Polyclonal Antibody for WB, IP, ELISA

Cat No. 32425-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

Epididymal secretory protein E3-beta, FAM12B, HE3B, HE3-beta, Human epididymis-specific protein 3-beta

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IP detected in: human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32425-1-AP targets EDDM3B in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37630

  Product name: Recombinant human EDDM3B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 55-118 aa of NM_022360

  Sequence: RENEALKDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESR

• Full Name: family with sequence similarity 12, member B (epididymal)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: NM_022360
• Gene Symbol: FAM12B
• Gene ID (NCBI): 64184
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P56851
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EDDM3B (Epididymal secretory protein E3-beta), also known as FAM12B, HE3B (Human epididymis-specific protein 3-beta), is highly enriched in the epididymis and is involved in the secretion of glycoproteins that interact with sperm membranes.