Product Information
87789-2-PBS targets EDEM1 as part of a matched antibody pair:
MP03204-1: 87789-1-PBS capture and 87789-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag41790 Product name: Recombinant human EDEM1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 564-657 aa of BC019088 Sequence: EDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI Predict reactive species |
| Full Name | ER degradation enhancer, mannosidase alpha-like 1 |
| Calculated Molecular Weight | 74 kDa |
| GenBank Accession Number | BC019088 |
| Gene Symbol | EDEM1 |
| Gene ID (NCBI) | 9695 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q92611 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



